PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI04G07710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 972aa    MW: 109602 Da    PI: 4.8765
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI04G07710.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.7e-14853248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
  OMERI04G07710.1  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                     78*****************************.************986 PP

2Myb_DNA-binding32.81.6e-1060103248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
  OMERI04G07710.1  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
CDDcd001675.65E-121053No hitNo description
PfamPF139214.5E-131070No hitNo description
SuperFamilySSF466896.47E-2133108IPR009057Homeodomain-like
CDDcd116591.75E-3055106No hitNo description
Gene3DG3DSA:1.10.10.603.4E-1457104IPR009057Homeodomain-like
PROSITE profilePS5129416.44358107IPR017930Myb domain
SMARTSM007171.7E-1258105IPR001005SANT/Myb domain
PfamPF118311.6E-60406658IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 972 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDAACAKD ENYEPNDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDTRQR KRKRKGIDYN AEIPFEKRPP PGFYDTVGED RPLEHVQFPT  240
TIEELEGKRR VDIEAQLRKQ DIARNKILQR QDAPAAIMQA NRLNDPEAVT KRSKLMLPPP  300
QISDHELEEI AKMGNAGDPS LVEELGEGST ATRALLSSYS QTPRLGMTPL RTPQRTLAGK  360
GDAIMMEAEN LARLRESQTP LLGGDNPELH PSDFSGVTPR KKEMQTPNPM ATPLASPGPG  420
ATPRIGMTPS RDGSSFGLTP KSTPFRDELR INEEVDMQDT AKLELRRQAE LRKSLRSGFA  480
SIPQPKNEYQ IVMPPITEEE KEEAEEKIEE DMSDRLARER AEEQARQEAL LRKRSKVLQR  540
SLPRPPAASI EFLRQTLIKG GESRSRSTFV PPTSLEQADE LINEELLRLL EHDNAKYPLD  600
EKTQKDKKKG SKRQANGTPS VPEIEDFDED ELKEANSMLE EEVQYLRVAM GHESESLEDF  660
VKAHDACQED LMFFPNNNSY GLASVAGNSD KIAALQYEFE IVKKRMDDEA KKASRLEQKI  720
KLLTQGYQVR AGKLWSQVQD TFKQMDTSAT ELECFQELQK QEQMAASYRI RNLTEEVNKQ  780
KALERTLQSR YGDLLTSYKR IQEQLEEHKR QLMIQEEMEA QKRAQEEEME AQKRAQAEEE  840
KEAAKAEEEA RKMDRAADEE AAGSKQVNED QMDVDNSNAD GDEFVGPIPP GPGTQGDDNV  900
VAVEENSSSQ GGDAATTDDG SCGMIDAPKS GGQDHTDSKD ELPTVGASLD DGSAAASSDQ  960
DVSTEVNATV AE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10332242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDTRQRKRKRK
2199204RKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1022480.0AK102248.1 Oryza sativa Japonica Group cDNA clone:J033088F07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636290.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLA0A0E0DCR80.0A0A0E0DCR8_9ORYZ; Uncharacterized protein
STRINGOB04G16480.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44163553
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5